McDonnell Genome Institute

Washington University

CircRNA

chr17|82091221|82092589|-|FASN|ENST00000306749.2

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9429

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

12

Peptide

SGSSALVGDPQELNGITR

Amino Acids from 5' Exons

VLLSLEHGLWAPNLHFHSPNPEIPALLDGRLQVVDQPLPVRGGNVGINSFGFGGSNVHIILRPNTQPPPAPAPHATLPRLLRASGRTPEAVQKLLEQGLRHSQDLAFLSMLNDIAAVPATAMPFRGYAVLGGERGGPEVQQVPAGERPLWFICS,CCCPWSTGSGPPTCTSIAPTLRSQRCWMGGCRWWTSPCPSVAATWASTPLASGAPTCTSSGPTRSRPPHPPHMPPCPVCCGPADAPLRPCRSCWSRASGTARTWLSACTTSRLSPPPPCPSVATLCWVVSAVAQRCSRCPLASARSGSSAL,AAVPGARALGPQPALPPQPDPSAVGWAAAGGGPAPARPWRQRGHQLLWLRGLQRAHHPEAQHAAAPRTRPTCHPAPSAAGQRTHPGRAEAAGAGPPAQPGPGFPEHAERHRGCPRHRHALPWLRCAGWARWPRGAAGARWRAPALVHLL

Amino Acids from 3' Exons

VGDPQELNGITRALCATRQEPLLIGSTKSNMGHPEPASGLAALAK,WATPRSMASPEPCAPPARSRCSSAPPSPTWGTRSQPRGWQPWP,GRPPGAEWHHPSPVRHPPGAAAHRLHQVQHGAPGASLGAGSPGQ