McDonnell Genome Institute

Washington University

CircRNA

chr17|82088760|82096452|-|FASN|ENST00000306749.2

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9169

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

AAMEEVVIAGMSGK

Amino Acids from 5' Exons

AVLKRGLKPSCTIIPLMKKDHRDNLEFFLAGIGRLHLS,LSSVASRAAPSSPRRITGTTWSSSWPASAGCTSQ,CPEAWPEAELHHHPPDEEGSQGQPGVLPGRHRQAAPLR

Amino Acids from 3' Exons

SSHGGGGDCRHVREAARVGELAGVLGQPHRRCGHGHGRPSLEG,AAMEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDRRWKA,QPWRRWLPACPGSCQSRRTCRSSGTTSSAVWTWSRTMTVAGRR