McDonnell Genome Institute

Washington University

CircRNA

chr17|81859180|81859387|-|P4HB|ENST00000331483.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9711

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

14

Peptide

FFRNGDTASPKEYTDAPWCGHCK

Amino Acids from 5' Exons

MPLGVATARLWPLSMPKPLGSRQKVPRSGWPRWTPRRSLTWPSSTACAAIPPSSSSGMETRLPPRNIQ,CPLVWPLQGSGPVCQSRWEAEGRRFRDQVGQGGRHGGVPGPAVRRARLSHHQVLQEWRHGFPQGIY,APWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYT

Amino Acids from 3' Exons

MPLGVATARLWPLSMPKPLGSRQKVPRSGWPRWTPRRSLTWPSSTACAAIPPSSSSGMETRLPPRNIQ,CPLVWPLQGSGPVCQSRWEAEGRRFRDQVGQGGRHGGVPGPAVRRARLSHHQVLQEWRHGFPQGIY,APWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYT