McDonnell Genome Institute

Washington University

CircRNA

chr17|81512231|81512781|-|ACTG1|ENST00000575842.5

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9997

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

28

Peptide

LSPSFSGQVAMEEEIAALVIDNGSGMCK

Amino Acids from 5' Exons

LSHSVLPPLRRRVSLPVSAPPRGLSWTSQACAPRPRLAPLPAAEASSRLPREQKAGWAGSGGRGWGGAGGPGRGPAAVQTSEPWTLRKRPGLRFQAVAILEATAAGVGAGPRLPRGRALGGCGEGTVLQTRPPESILFRAGRNGRRDRRAGHQWLRHVQSWFCWGRRSPSRVSFHRRAPQTP,SRTLFFRRSAVAFLCRAPRPGAAGRRRPAPPDPGWPRFQLPRPRRAFPGNKRRGGPGQADGAGGAPGVQGGARPQCRLPSRGRYVKGPAFGSRRLRSWRPRPLGLGQGRGFPAGGHVAVGRGPCYRRARLSPSFSGQVAMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ,LALCSSAAPPSRFSAGERPAPGPELDVAGLRPPTPAGPASSCRGLVAPSPGTKGGVGRVRRTGLGGRRGSRAGPGRSADFRAVDVTKARPSVPGGCDLGGHGRWGWGRAEASPREGIRWLWGGDRVTDAPAVHPFPGRSQWKKRSPRWSLTMAPACAKLVLLGTTLPEPCFLPSSGAPDT

Amino Acids from 3' Exons

LSHSVLPPLRRRVSLPVSAPPRGLSWTSQACAPRPRLAPLPAAEASSRLPREQKAGWAGSGGRGWGGAGGPGRGPAAVQTSEPWTLRKRPGLRFQAVAILEATAAGVGAGPRLPRGRALGGCGEGTVLQTRPPESILFRAGRNGRRDRRAGHQWLRHVQSWFCWGRRSPSRVSFHRRAPQTP,SRTLFFRRSAVAFLCRAPRPGAAGRRRPAPPDPGWPRFQLPRPRRAFPGNKRRGGPGQADGAGGAPGVQGGARPQCRLPSRGRYVKGPAFGSRRLRSWRPRPLGLGQGRGFPAGGHVAVGRGPCYRRARLSPSFSGQVAMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ,LALCSSAAPPSRFSAGERPAPGPELDVAGLRPPTPAGPASSCRGLVAPSPGTKGGVGRVRRTGLGGRRGSRAGPGRSADFRAVDVTKARPSVPGGCDLGGHGRWGWGRAEASPREGIRWLWGGDRVTDAPAVHPFPGRSQWKKRSPRWSLTMAPACAKLVLLGTTLPEPCFLPSSGAPDT