McDonnell Genome Institute

Washington University

CircRNA

chr17|81511187|81511626|-|ACTG1|ENST00000331925.6

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9983

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

LSEATASPPRPSGK

Amino Acids from 5' Exons

IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFL,LCLRPSTPRPCTWPSRPCCPSTPLGAPLALSWTLETGSPTRCPSTRATPSPTPSCVWTWLAGTPTTSRSSLSEATASPPRPSGKSCATSRRSCATSPWTSSRRWPPPHPPLLWRRATSCPMARSSPLAMSGSGVRRRCSSLPSW,YVDLQHPGHVRGHPGRAVPLRLWAHHWHCHGLWRRGHPHGAHLRGLRPPPRHPASGPGWPGPDRLPHEDPHARLQLHHHGRAGNRARHQGEAVLRRPGLRAGDGHRRILLFSGEELRAARWPGHHHWQAVPVSGGAVPAFLP

Amino Acids from 3' Exons

IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFL,LCLRPSTPRPCTWPSRPCCPSTPLGAPLALSWTLETGSPTRCPSTRATPSPTPSCVWTWLAGTPTTSRSSLSEATASPPRPSGKSCATSRRSCATSPWTSSRRWPPPHPPLLWRRATSCPMARSSPLAMSGSGVRRRCSSLPSW,YVDLQHPGHVRGHPGRAVPLRLWAHHWHCHGLWRRGHPHGAHLRGLRPPPRHPASGPGWPGPDRLPHEDPHARLQLHHHGRAGNRARHQGEAVLRRPGLRAGDGHRRILLFSGEELRAARWPGHHHWQAVPVSGGAVPAFLP