McDonnell Genome Institute

Washington University

CircRNA

chr17|81099927|81104715|+|BAIAP2|ENST00000321280.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9549

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

ITSTPSATSR

Amino Acids from 5' Exons

YIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSK,TSTPSATSRASWRITCPTATRPHQRSAGASASWWRSSAPWPRTPRPTTP,HRRHQQQAGRAGELRVRRLQDRTDRGAQALLLPGGEAVRRGQELRGLPLQ

Amino Acids from 3' Exons

PRTRLCLARAPWQPAWSAMAVCGRPSSPTLLGTTAPSASRRVTSLPCWCLRPAMAGTTERVRRPR,REQDSASLELHGSRPGAQWPYAGEGHLLPRCWGQQHPPELQGGPHYPAGAGPRWLALRREEDQD,ENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTK