McDonnell Genome Institute

Washington University

CircRNA

chr17|80880414|80885148|+|RPTOR|ENST00000306801.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9967

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

6

Peptide

EPHGPEVVPSGPR

Amino Acids from 5' Exons

SCQADLVKDNGHKYFLSVLADPYMP,RAKRTSRTTATSTSCRSWRTPTC,VPSGPREGQRPQVLPVGPGGPLHA

Amino Acids from 3' Exons

VRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLVSDGSPMVRK,SAAQRSSPLARSWATLQRGRTTPPPSTTTWPCWPSWSATGAPWSG,PLRSGLRPWHVRGQLCREDGPLHHHRPQRGHDAGPAGQRREPHGPE