McDonnell Genome Institute

Washington University

CircRNA

chr17|80361733|80368143|+|RNF213|ENST00000508628.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9734

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

LPCQTNSLQLFPK

Amino Acids from 5' Exons

DCPRSSWTSFSRLLWAGFLPSSMESRSRNFFSVTRISFSPCVCQRRRN,TAQEVRGHLSADSSGQVSCPAPWRAAAGTSSVLLEGFHSLDHACVNGGGIK,LPKKFVDIFQQTPLGRFLAQLHGEPQQELLQCYLKDFILLTMRVSTEEELK

Amino Acids from 3' Exons

VWDSAVLHLPGRCKGPRLSALRPRALPALPQGLVCLRADDMPLLFNCLARRILSSCFPSAQ,FGIQPCSICLGDAKDPVCLPCDHVHCLRCLRAWFASEQMICPYCLTALPDEFSPAVSQAH,LGFSRAPSAWEMQRTPSVCPATTCTACAASGPGLPQSRYAPTVLPCQTNSLQLFPKRT