McDonnell Genome Institute

Washington University

CircRNA

chr17|80332005|80332631|+|RNF213|ENST00000508628.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9831

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

8

Peptide

LDFGVLAVR

Amino Acids from 5' Exons

WTLECLQDTHKTSAVKDMTPQDCPPPRTRRGQRITTAPRSKKWLGRTCSETATSSSSSGGKPQSRVSLRRTRKPQSCVSPKKNQKGTSLSLKRCMTICISLLTESSLSCTRISQERSPLQRLMSSSRTLINTRTWIQNLRSCAPWTTRTKEIGSRTESNRSRNTITCTRLSTQPRSSCRSKRAWDTVTSVFSTLYI,GLWSACSKTLTRPQQKIKHRDSETVHLLELAEGNALPPELPGPRNGWEDRLAQRQPHLPALLAGSRRAAEAGGPGSRRVAEARRRIRKAHPARGVLFVSAFLQKVHVAPGSKVRRGHPCRDCHLQGLCEIHGPGFRTDHVHRGPPGPKRLDQGPSRTDQGIPSPAPGCPRSQGHLAGQREPGTERLQCSQHFTKF,DFGVLAVRHSQDLSSKRLNDTVTVRLSTSSNSQRATHYHLSSQVQEMAGKIDLLRDSHIFQLFWREAAEPLSEPKEDQEAAELLSEPEEESERHILELEEVYDYLYQPSYRKFIKLHQDLKSGEVTLAEIDVIFKDFVNKYTDLDSELKIMCTVDHQDQRDWIKDRVEQIKEYHHLHQAVHAAKVILQVKESLGLNGDFSVLNTLLNF

Amino Acids from 3' Exons

WTLECLQDTHKTSAVKDMTPQDCPPPRTRRGQRITTAPRSKKWLGRTCSETATSSSSSGGKPQSRVSLRRTRKPQSCVSPKKNQKGTSLSLKRCMTICISLLTESSLSCTRISQERSPLQRLMSSSRTLINTRTWIQNLRSCAPWTTRTKEIGSRTESNRSRNTITCTRLSTQPRSSCRSKRAWDTVTSVFSTLYI,GLWSACSKTLTRPQQKIKHRDSETVHLLELAEGNALPPELPGPRNGWEDRLAQRQPHLPALLAGSRRAAEAGGPGSRRVAEARRRIRKAHPARGVLFVSAFLQKVHVAPGSKVRRGHPCRDCHLQGLCEIHGPGFRTDHVHRGPPGPKRLDQGPSRTDQGIPSPAPGCPRSQGHLAGQREPGTERLQCSQHFTKF,DFGVLAVRHSQDLSSKRLNDTVTVRLSTSSNSQRATHYHLSSQVQEMAGKIDLLRDSHIFQLFWREAAEPLSEPKEDQEAAELLSEPEEESERHILELEEVYDYLYQPSYRKFIKLHQDLKSGEVTLAEIDVIFKDFVNKYTDLDSELKIMCTVDHQDQRDWIKDRVEQIKEYHHLHQAVHAAKVILQVKESLGLNGDFSVLNTLLNF