McDonnell Genome Institute

Washington University

CircRNA

chr17|80327815|80334270|+|RNF213|ENST00000508628.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9757

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

4

Peptide

EALGGTDEK

Amino Acids from 5' Exons

EPTRKYQMSQRMPRGLLPTLCRKLLVTSVARFLDNWSLSTRISFLTSGN,NRRENTSKCHRGCQEADSCCRLCVDESCWPPKWHDFSWTTGADYKAQESVSHLAT,TDEKILANVTEDAKRLIAVADSVLTKVVGDLLSGTILVGQLELIIKHKNQFLDIWQL

Amino Acids from 3' Exons

TDNFDDFRRETLDQINQELIQAKKLLQDISEARCKGLQALSLRKEFICWVREALG,LITSTTFAVKHWTRSTRSSSRPKSCSRTSARPGARGCRLCPERSSSAGSGRLLE,LRRLSPNTGPDQPGAHPGQKAAPGHQRGPVQGAAGSVPEKGVHLLGPGGSW