McDonnell Genome Institute

Washington University

CircRNA

chr17|80050063|80058980|+|CCDC40|ENST00000269318.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9224

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

5

Peptide

KAVSEVVATK

Amino Acids from 5' Exons

VVATKQSRAQRQELGVNLYEVQQHLVHLQKLLEKSHDRHAMASSERRQKEEELQAARALYTKTCAAANEERKK,LWLPSRAEPSGRSWGISMRCSSTWYTCRSCWRRVTTATQWPRASAGRRRRSCRPPALSTPRPAQPPTRSAKS,CGYQAEPSPAAGAGGESLGAAAPGTPAEAAGEESRPPRNGLERAQAEGGGAAGRPRSLHQDLRSRQRGAQK

Amino Acids from 3' Exons

DLYVDQLTTRAQQLEEDIALFEAQYLAQAEDTRILRKAVSE,TCMWTSSPLEPSNWKKTLPCLRLSTWPKLRTPGFGKQV,PVCGPAHHSSPATGRRHCPVGSVLGPSGHPDFKESSE