McDonnell Genome Institute

Washington University

CircRNA

chr17|7936237|7937262|+|CNTROB|ENST00000571540.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9977

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

FGAVVIPK

Amino Acids from 5' Exons

TYSVLGTQASWLQPTPPLEELESLVLWSYQRWATPRLLTLFPSIVSAIFRACRPECSYSNNPWLWLPTARKIPLNNWT,PILFLGPKLLGSSPLPHRSWKVWCCGHTKDGQHPDSSPFSPALAPYSEPADPSVRATATISRGCGCRPQERYHDTTGQ,LFCSWDPSFLAPAHSPTRGAGKFGAVVIPKMGNTQTPHPFPQHCERHIQSLQTRVLELQQQLAVAVAADRKKDTMIEQLDK

Amino Acids from 3' Exons

TVTRLEQSLSEAMEALNREQESARLQQRERETL,QPAWNKAFLRPWRPIVSRKVPDCSNGKERH,SNPPGTKPFGHGGPESAGKCQTAATGKRDT