McDonnell Genome Institute

Washington University

CircRNA

chr17|78803384|78803978|-|USP36|ENST00000312010.10

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

AAGSGGGK

Amino Acids from 5' Exons

GCVTCSPIIQPPATPLQPPPHIAVQYPQAPRDVRTTELLLHLDGAASGQRGPCVSSTPVARGQAPPEPLEEEKDLCGRAAEAGLRDAPPTAHQGGHCGSPREEEEEEEEAPGGHSCQRPAGGADTETAWEPHVQEGGPGTAARCQTAGRWHTATGEWPAGGMCYGRPPREQQEAEEERSRRSWRRRPAPGPTSAQ,AVSPAPQSSSRLQPPFSPHPTLLSSTPKPPGTSEPRSCSSISTALPQVNEDLVSLPHQLPEASEPPQSPSEKRKKTFVGEPQRLGSETRLPQHIREATAAPHGKRKRKKKKRPEDTAASALQEGQTQRQPGSPMYRREGQAQLPAVRRQEDGTQPQVNGQQVGCVTDGHHASSRKRRRKGAEGLGEEGGLHQDPLRH,LCHLLPNHPAACNPPSAPTPHCCPVPPSPQGRQNHGAAPPSRRRCLRSTRTLCLFHTSCQRPVSPPRAPLRRGKRPLWESRRGWAQRRASHSTSGRPLRLPTGRGRGRRRSARRTQLPAPCRRGRHRDSLGAPCTGGRARHSCPLSDGRKMAHSHRMASRWDVLRTATTRAAGSGGGKEQKVLVKKAACTRTHFGT

Amino Acids from 3' Exons

GCVTCSPIIQPPATPLQPPPHIAVQYPQAPRDVRTTELLLHLDGAASGQRGPCVSSTPVARGQAPPEPLEEEKDLCGRAAEAGLRDAPPTAHQGGHCGSPREEEEEEEEAPGGHSCQRPAGGADTETAWEPHVQEGGPGTAARCQTAGRWHTATGEWPAGGMCYGRPPREQQEAEEERSRRSWRRRPAPGPTSAQ,AVSPAPQSSSRLQPPFSPHPTLLSSTPKPPGTSEPRSCSSISTALPQVNEDLVSLPHQLPEASEPPQSPSEKRKKTFVGEPQRLGSETRLPQHIREATAAPHGKRKRKKKKRPEDTAASALQEGQTQRQPGSPMYRREGQAQLPAVRRQEDGTQPQVNGQQVGCVTDGHHASSRKRRRKGAEGLGEEGGLHQDPLRH,LCHLLPNHPAACNPPSAPTPHCCPVPPSPQGRQNHGAAPPSRRRCLRSTRTLCLFHTSCQRPVSPPRAPLRRGKRPLWESRRGWAQRRASHSTSGRPLRLPTGRGRGRRRSARRTQLPAPCRRGRHRDSLGAPCTGGRARHSCPLSDGRKMAHSHRMASRWDVLRTATTRAAGSGGGKEQKVLVKKAACTRTHFGT