McDonnell Genome Institute

Washington University

CircRNA

chr17|78392475|78398351|+|PGS1|ENST00000262764.10

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9683

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

6

Peptide

LHAGLTR

Amino Acids from 5' Exons

VTMAVIGSLAVPSCSPGHLPTLLPVSRRRAPVPVDQKPGSRIWSLQFSRGAFFPGRVFRAHE,SPWLLLAPLLSPAVPQVTSPPCCLCPEGVHRFQWIRNLVPEFGVSSSHVRVLSSPAEFFELMK,HHGCYWLPCCPQLFPRSPPHLAACVQKACTGSSGSETWFQNLESPVLTLGCFLPRQSFSSS

Amino Acids from 3' Exons

VDCLESTLEKSLQAKFPSNLKVSILLDFTRGSR,WTAWKVLKSHSKQSFLQISRSPFSTSRGAHE,GLPGKYSRKVTPSKVSFKSQGLHSLRLHAGLT