McDonnell Genome Institute

Washington University

CircRNA

chr17|78031515|78051457|+|TNRC6C|ENST00000301624.8

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

SEANCSWDK

Amino Acids from 5' Exons

CQNLLRPVQASPNLPVPVPVLPPALSQAATMANVHLPVASSQLHPVTCLVRCLHASASKNRSSYREASHCLRGLPVAQPRVLGLQGAHLPYLEPEHSIIPVSSNQ,ARTYDLFKPAPTCRYQYQYFHQHYLKQQQWQTCICQWPAASCIPLPASGASTLPPARTEAAIKERPAIAYGDSNQCEPNPGCWACRGKPTSPTWSRNTASSQAPT,PEPTKTCSSQPQPAGTSTSTSTSTISSSNNGKRASASGQQPAASRYLPREVPPRFRQQEQKQLLKRGQPLPTGTLTSVSPTQGAGPAGVSPPPLPGAGTQHHPSKLQP

Amino Acids from 3' Exons

ISVIVDWQIIMKIPTGDSSLLTEAKPTAAGIKIGLTRRRGLPSQEQRLNLPQNVLQTLTLPPTVAQRTVAWLQGVPRATSLDIPRRQMAIMAPMAHSSKALLIRVPLEQGERTVMEVRPECGVPQAPALAWLTALSVVGMEKWTLLEMGEVRIAGVLPTPMLALILTLILMPTQLPGLYLDMKEPWRQATLPVFAVQSVPVKIWATRTGTQQALVLGETCCHKRAQNHKRPLLRMCLSAHNLRTLTLMDQITLTPTLHPTLSMQCRQMDCQTGAWLLVWGPSSRPTCKAFLVLMDHQFLKSVGAVLKEAILCGDCPQVTLPQEIAILGSVRGMETLTQHVLNKMDPAVLCKRKEVEEMLGIQDLLLVLEYSPGEGAVATMALVISIQELGATPAEAPLTVMGNGESPQTSIPTVTSMGKDQQGGRVLVSPARTLPYSLVVNTTPGPKRHLLELQQVKEVVMVLATTMKEALGGKEREKAEGEIKGLTKGTSSCQGMILTQEFCLILVGDRLLSKTLPGNLKNPLGLKGKMTMGQRPGVVQLLRLQTQGGRTMGPSTVQIPLQYLGGSTRHLPLCQQTQVGETATTKRQVARGFGGTRALLLLVLLLLPRVAMLGVGPQIRRTSHPPGVSLQSPNPNTGEMDKDQIQPGVQEGEIGQIHRLSLDTWGMGKKMDLDGMLTVIGQGLVGMTPRDLGTVAGATAQIQRPIQVQTGGRLNLAPNRTGLANPKTTMVTGEELLLNRQEQGGSGGRYRSNRRTAVKQLAGKNPLHRPFAAKWKLMMVPQLGGTQATITIKLTCGIETTRSSRAVPRPIPPPPPPLPRATPHTGSRRRPRTRPVLSIDHRCLVQVGK,SQSWIGRSLKFPLGTAAYLQKRSQLQLGSDNRDQGGVAFHHRNRDICLRMYYRHLCLQLWLREQHGYRECPGQLHWTYQEDKWQWHQWRTRPKPFSECPWSRGSEQWKCGQSVGCSHRLQLWPGSLLCQWWGWKNGHYDWRWEKSELLGCFQLQCWHSPSCQPSCLACTWTRNRGDRQPFQYLQSSQCHRSKYGQPEREPNRHFRCLGKLAATREHRTTNVHFSECVFQRTTSEPHWTKHPHELFTQPYQCNADKWTAKLGHGCWYGGHHPAPPARPSWCWIISFSSQWGQCRNKQFCVGTVPRPCHRKQFWVQSGEWRHCELSIKCTKWIQQCCAKGRKWRKCLGFRTSCWSWNTRLGKGQWQQWRWYPFRSLGPPQPKHLRCEWGMGKAPKPAFQQHQWERINRVGESCHQPEPYRTAWWTHELLGQSGIFWNYSKRKWFWQPQRKHWEGRNGRRPKARRDYRPRAHPVAKESPKSSVYWLGTDSCKAKHCLGIRIPVKEKQWDRGLGLCSYSGFKLRGEERWVHHEQYKYLFSIWVGQRATCRCASKHRLGRQQQQSAKWPGGLGGLDKLYCCYCCCCQEWPCLEWGRKSGGQVTHLGASKAQIPTLGRWTKIKSSLECRRGRLGRFIVCPWTLGGWEKKWIWMGCQVRVWLEHHEIWEQWLGQQHKYKGQSRYKLGGDFKTWPPTELGQTPRQQCELGRSCFCETDRNRVDRGAGTGQTEGQQSNWLGRTLSTVHSPQNGNWYLSLGGPKQLQNCKHVGKQPGHPEQYHDQYHHHHHHYHEQHHTQGRDAAPAPGRYSAESITVAWSRE,LSHSGLADHYENSHWGQQPTYRSEANCSWDKVIIDRTDKEAWPSITGTETESASECTTDTDSASNCGSENSSMATGSAQGNFTGHTKKTNGNNGTNGALVQSPSNQSALGAGGANSNGSAARVWGVATGSSSGLAHCSVSGGDGKMDTMIGDGRSQNCWGASNSNAGINLNLNPNANPAAWPVLGHEGTVATGNPSSICSPVSAIGQNMGNQNGNPTGTLGAWGNLLPQESTEPQTSTSQNVSFSAQPQNLNTDGPNNTNPMNSSPNPINAMQTNGLPNWGMAVGMGAIIPPHLQGLPGANGSSVSQVSGGSAEGISNSVWGLSPGNPATGNSNSGFSQGNGDTVNSALSAKQNGSSSAVQKEGSGGNAWDSGPPAGPGILAWGRGSGNNGVGNIHSGAWGHPSRSTSNGVNGEWGKPPNQHSNSDINGKGSTGWESPSVTSQNPTVQPGGEHMNSWAKAASSGTTASEGSSDGSGNHNEGSTGREGTGEGRRRDKGIIDQGHIQLPRNDLDPRVLSNTGWGQTPVKQNTAWEFEESPRSERKNDNGTEAWGCAATQASNSGGKNDGSIMNSTNTSSVSGWVNAPPAAVPANTGWGDSNNKAPSGPGVWGDSISSTAVSTAAAAKSGHAWSGAANQEDKSPTWGEPPKPKSQHWGDGQRSNPAWSAGGGDWADSSSVLGHLGDGKKNGSGWDADSNRSGSGWNDTTRSGNSGWGNSTNTKANPGTNWGETLKPGPQQNWASKPQDNNVSNWGGAASVKQTGTGWIGGPVPVKQKDSSEATGWEEPSPPSIRRKMEIDDGTSAWGDPSNYNNKTVNMWDRNNPVIQSSTTTNTTTTTTTTTSNTTHRVETPPPHQAGTQLNRSPLLGPGRK