McDonnell Genome Institute

Washington University

CircRNA

chr17|77482143|77488321|+|SEPT9|ENST00000329047.12

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9346

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

3

Peptide

TATEAAPSCVGDMADTPR

Amino Acids from 5' Exons

PLRRLPAALATWPTPPEMPGSSRRLHHGTRRPRWTSATWGLTPSWSRCAGRPSRASSSTSWWS,HGGSQLRWRHGRHPQRCRAQAGACITEREGPGGLRLRGDLHPGADAPEGHEAGLRVQHHGG,TEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVV

Amino Acids from 3' Exons

ILRRKASGSQLTHQGSGTTSTTRT,YGERRPDEADSDHTRVRGPHQQREL,IEEKGVRMKLTVIDTPGFGDHINNEN