McDonnell Genome Institute

Washington University

CircRNA

chr17|76629011|76629711|-|ST6GALNAC1|ENST00000156626.11

Cancer

Type of Peptide

BRCA-Basal-like

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

WGPDQEADGLQDGVR

Amino Acids from 5' Exons

ASTHREHRKVSTVPGKAVPGTHKGKEDNHLCRASAREQCPQHTNPAQGPHHRRQRKGGQPGTAGGAGQGAPHSTEGSMEEPRKRENHGEHTVTQRARCRDGLWQDRGTIMEEPGHKDDPRKWGPDQEADGLQDGVREAPGQSGNHSQDAHSQKSAQNAGSHRSSVNKDETERSDHSSHPTGEETSGHPTPCPFPEPHDAEKPKTEGRQLQIASVGFGKIQLRNRRPSD,HQRTENIKERSLQSLAKPKSQAPTRARRTTIYAEPVPENNALNTQTQPKAHTTGDRGKEANQAPPEEQDKVPHTAQRAAWKSPEKEKTMVNTLSPRGQDAGMASGRTEAQSWKSQDTKTTQGNGGQTRKLTASRTVSEKHQGKAATTAKTLIPKSQHRMLAPTGAVSTRTRQKGVTTAVIPPKEKKPQATPPPAPFQSPTTQRNQRLKAANFKSEPRWDFEEKYSFEIGGLQT,INAQRTLKKGLYSPWQSLSPRHPQGQGGQPSMQSQCQRTMPSTHKPSPRPTPPETEERRPTRHRRRSRTRCPTQHRGQHGRAQKKRKPWTHCHPEGKMQGWPLAGQRHNHGRARTQRRPKEMGARPGSRPPGRCQRSTRAKRQPQPRRSFPKVSTECWLPQEQCQQGRDRKEPQQSSHLRRRNLRPPHPLPLSRAPRRRETKDRPPTSNLSLGGILRKNTASKEAFR

Amino Acids from 3' Exons

ASTHREHRKVSTVPGKAVPGTHKGKEDNHLCRASAREQCPQHTNPAQGPHHRRQRKGGQPGTAGGAGQGAPHSTEGSMEEPRKRENHGEHTVTQRARCRDGLWQDRGTIMEEPGHKDDPRKWGPDQEADGLQDGVREAPGQSGNHSQDAHSQKSAQNAGSHRSSVNKDETERSDHSSHPTGEETSGHPTPCPFPEPHDAEKPKTEGRQLQIASVGFGKIQLRNRRPSD,HQRTENIKERSLQSLAKPKSQAPTRARRTTIYAEPVPENNALNTQTQPKAHTTGDRGKEANQAPPEEQDKVPHTAQRAAWKSPEKEKTMVNTLSPRGQDAGMASGRTEAQSWKSQDTKTTQGNGGQTRKLTASRTVSEKHQGKAATTAKTLIPKSQHRMLAPTGAVSTRTRQKGVTTAVIPPKEKKPQATPPPAPFQSPTTQRNQRLKAANFKSEPRWDFEEKYSFEIGGLQT,INAQRTLKKGLYSPWQSLSPRHPQGQGGQPSMQSQCQRTMPSTHKPSPRPTPPETEERRPTRHRRRSRTRCPTQHRGQHGRAQKKRKPWTHCHPEGKMQGWPLAGQRHNHGRARTQRRPKEMGARPGSRPPGRCQRSTRAKRQPQPRRSFPKVSTECWLPQEQCQQGRDRKEPQQSSHLRRRNLRPPHPLPLSRAPRRRETKDRPPTSNLSLGGILRKNTASKEAFR