McDonnell Genome Institute

Washington University

CircRNA

chr17|76396127|76398991|-|UBE2O|ENST00000319380.11

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9105

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

4

Peptide

GEVFSVLEFAPWWQWR

Amino Acids from 5' Exons

HLYNIESEIEESDYDSVEGSTSGASSDEWEDDSDSWETDNGLVEDEHPKIEEPPIPPLEQPVAPEDKGVVISEEAATAAVQGAVAMAAPMAGLMEKAGKDGPPKSFRELKEAIKILESLKNMTVEQLLTGSPTSPTVEPEKPTREKKFLDDIKKLQENLKKTLDNVAIVEEEKMEAVPDVERKEDKPEGQSPVKAEWPSETPVLCQQCGGKPGVTFTSAKGEVFSVLEFAP,TCTTSLRLRSQTTIRKAAPAGHPRMNGKMIVTAGRRTMGWWRTSTPRRSPPSHPWSSRWPLRTREWSVKRQPQLPSRGLWPWLPPWPGWRRLARTGHPRASGSKRPSRSWRASRTLWSSCRARPPLRLWSLRSQLGRRSFWMTSRSYRKTSRRPWTMWPLRRRRWKQCPTSARRTSPRGSHLRLSGPAKPRCCASSVAASLASPSPAPRARSSPYWSLHP,LVQHRVDGVRLRFGRRQHQRGILGMGRQLGDGQWAGGGRAPQDRGAPHPTPGAAGGPGQGSGDQRGSHSCRPGGCGHGCPHGRADGEGWQGRATQELPGVERGHQDPGEPQEHDCGAAADGLAHLSDCGAEANSGEEVSGHQEATGKPQEDPGQCGHCRGGEDGSSARRRAQGGQARGAVTCEGVAQRNPGAVPAVWRQAWRHLHQRQGRGLLRTGVCT

Amino Acids from 3' Exons

GGSGGGDHDDLSRRDVAGWLRGMQHPLQRPLPCAPPGQQRVLPWRLRGRA,VAVEVVTTMTSADVMWQDGSVECNIRSNDLFPVHHLDNNEFCPGDFVVDKR,WQWRWPRPQPTCGRMAPWNATSAPTTSSLCTTWTTTSSALETSWISE