top of page

McDonnell Genome Institute

Washington University

CircRNA

chr17|75950773|75960375|-|ACOX1|ENST00000293217.9

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

56

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

28

Peptide

GRPEPLDLHLGMFLPTLLHQATAEQQER

Amino Acids from 5' Exons

LHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTFEGENTVMMLQTA,FMPSPLDRLSPPGLQTLALKHVGWLVVGMAILIAVVFQIFMSISPQAVPLREKTLSCSRRL,SCPHRWTEGFHLLDCKHWHSMSDGLWWAWLFSLQWSSKYLCQFHPKLYLGRKHCHDAPDG

Amino Acids from 3' Exons

FCAPRAAASGSSLGHVPAHLASPGNCGAAGALLHARLELGDHWHLCPDRDGS,FVHRGRPEPLDLHLGMFLPTLLHQATAEQQERFFMPAWNLEIIGTYAQTEMGH,LCTEGGLSLWIFTWACSCPPCFTRQLRSSRSASSCPPGTWRSLALMPRQRWVM

bottom of page