McDonnell Genome Institute

Washington University

CircRNA

chr17|75948250|75953620|-|ACOX1|ENST00000293217.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

14

Peptide

AEVKPDGTYVKPLSNK

Amino Acids from 5' Exons

GSIMTEPQITQVNQRVKELLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAE,GASQSLRLHKTSVRSYSLFAQMLLLWLMHLIFRMHLALCLAAMMGMCMKTCLSGLRTPHTKQ,EHHDRASDYTSKPACKGVTHSDSLRCCCFGCIFSGCDTWLCAWPLWECVKLVVGELPTEQSR

Amino Acids from 3' Exons

VKPDGTYVKPLSNKLTYGTMVFVRSFLVGEAARALSKACTIAIRYSAVRHQSEIKP,SLMAHTNRVTSLTGPWCLSGPSLWEKLLGLCLRRAPLPSDTALGTSLKSSQ,EAWHIRETAEQADLRDHGVCQVLPCGRSCSGSVGVHHCHPIQRCEAPVNQAR