McDonnell Genome Institute

Washington University

CircRNA

chr17|75948250|75949897|-|ACOX1|ENST00000293217.9

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9905

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

AEVPDEK

Amino Acids from 5' Exons

GSIMTEPQITQVNQRVKELLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAE,GASQSLRLHKTSVRSYSLFAQMLLLWLMHLIFRMHLALCLAAMMGMCMKTCLSGLRTPHTKQ,EHHDRASDYTSKPACKGVTHSDSLRCCCFGCIFSGCDTWLCAWPLWECVKLVVGELPTEQSR

Amino Acids from 3' Exons

VPDEKLSGALRKVGVWHGVLFERPAQSAHPATAGSSLANHGGYQQPRKPNRSITPCSQ,FLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSPESLTEAYKLRAA,SKVMIRCTQESWCVAWCPITTCPVSASSHSRQSGQPWWISTAPKAPKHINSVQP