McDonnell Genome Institute

Washington University

CircRNA

chr17|75901200|75901920|-|MRPL38|ENST00000309352.3

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9076

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

8

Peptide

LWTLLLTSLASVPLDAVR

Amino Acids from 5' Exons

AAQAPEVTYEAEEGSLWTLLLTSL,LPKRQRPMRQKRAPCGRCYSLAW,CPSARGDLGRRGLLVDVATHL

Amino Acids from 3' Exons

PVSRWMPCGPSGRGPVAPTTSSVWLSITASTETCSTVPPLCPESPCTWPTLWVRMTCLCTVAMRLQP,QCPAGCRAGRVGEDLWPLPQAASGVLRPLPRPVPRCHLCAPSPPARGLRCGGPDACVLWQGDSNR,SVPLDAVRAEWERTCGPYHKQRLAEYYGLYRDLFHGATFVPRVPLHVAYAVGEDDLMPVYCGNEVTPTE