McDonnell Genome Institute

Washington University

CircRNA

chr17|75504811|75505073|-|CASKIN2|ENST00000321617.7

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9303

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

8

Peptide

VGLSPDSPGARTASR

Amino Acids from 5' Exons

VLEQHPDGRWKGHIHESQRGTDRIGYFPPGIVEVVSKRVGIPAARLPSAPTPLRPGFSRTPQPPAEEPPHPLTYSQLPRVGLSPDSP,CNSIPTAAGRATSTRARGAQTAATSPRALSRWSASGWASLQPASPPHPPPCAQASPGHRSLLPKNPRTLLPTASFLGWASAQTAQ,ARTASRRPLEGPHPREPEGHRPHRLLPPGHCRGGQQAGGHPCSPPPLRTHPPAPRLLPDTAASCRRTPAPSYLQPASSGGPQPRQP

Amino Acids from 3' Exons

VLEQHPDGRWKGHIHESQRGTDRIGYFPPGIVEVVSKRVGIPAARLPSAPTPLRPGFSRTPQPPAEEPPHPLTYSQLPRVGLSPDSP,CNSIPTAAGRATSTRARGAQTAATSPRALSRWSASGWASLQPASPPHPPPCAQASPGHRSLLPKNPRTLLPTASFLGWASAQTAQ,ARTASRRPLEGPHPREPEGHRPHRLLPPGHCRGGQQAGGHPCSPPPLRTHPPAPRLLPDTAASCRRTPAPSYLQPASSGGPQPRQP