McDonnell Genome Institute

Washington University

CircRNA

chr17|75485427|75486426|+|KIAA0195|ENST00000585105.5

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

22

4

Peptide

ASLSPGPVHAEGPQRPEGAAGGSAGR

Amino Acids from 5' Exons

GEPPSALGLSTRKALSVLKEQLEAVLEGHLRERKKCLTWK,ASLPQPWACPRGRPSASRSSWRQCWKDISGSGRSVRG,RASLSPGPVHAEGPQRPEGAAGGSAGRTSQGAEEVSDVE

Amino Acids from 3' Exons

EVWRSSFLHHSNRCSCFHWPGASLMLLAVLLLLGCCGGQPAGRCAPRGCSPTSPAVLSILPRHLGQTRALGGCHPQAAPGMGNLLSPLNGVRGLAGVRAPERDSLSTRDWGGKGSCGLGAAGWASPHSLWVRPLFPPTSRGVGLVNASALFLLLLLNLVLIGRQDRLKRREVERRLRGIIDQIQ,RCGEAASSTTVTAAPASTGRGPHSCYWPCCCCWAAAGDSQPGGVRPGAAPQPLQLCCPSCRGTWDRPGLLGAVTPKLLLGCKGTSSVPMGSEALVSGHQNGTVFPQGTGVGRGAVAWGLLGGRALTPCGCGLSFLPPAVGWGWMPRPCSCYCFSTLCSSGGKTGSVGRSGGCEGSLTKSK,GVEKQLPPPQPLLLLPLAGGLTHATGRAAAAGLLRGTASREVCAQGLLPNLSSCAVHPAAAPGTDQGSWGLSPPSCSWDVREPPQSLEWGQRPSWCQGTRTGQSFHKGLGWEGELWPGGCWVGEPSLPVGAASLSSHQPWGGAGECLGLVPVTASQPCAHRAARPAEASGGRAEAARDHPNP