McDonnell Genome Institute

Washington University

CircRNA

chr17|75277352|75286802|-|SLC25A19|ENST00000320362.7

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9968

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

19

Peptide

QGWLAMTPNQMAGITPSSR

Amino Acids from 5' Exons

RTSKTCFVAVELVSSARPHIRWTSSRSGYRLEGLSMPELPLA,EPPKPALWQWSWCHQQDPDISAGPLQEAATGWRVACQSCLWP,NLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQ

Amino Acids from 3' Exons

LDTDGHCVGQRQGWLAMTPNQMAGITPSSRWQWLGLCLDLLLGRSVPSTSSRSVS,LILMDIVWARGRDGWLPQTRWQEHQVPGGSGWVCVWTCYSGADQSLRRHQDPFP,YWTLCGPEAGMVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQ