McDonnell Genome Institute

Washington University

CircRNA

chr17|73199864|73201900|+|COG1|ENST00000299886.8

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9925

34

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

ALVSCRK

Amino Acids from 5' Exons

ERALVSCRKRNSAAGLNTCQHPSSSSSQHSEPLHIPSVRNTKTRCRNGST,KGHWCPAGRDETLQLVTPASIHRRVPANTPNPCTSHQSGIPERHAAEMDPH,KGTGVLQEEMKLCSWFKHLPASIVEFQPTLRTLAHPISQEYLKDTLQKWIH

Amino Acids from 3' Exons

TLTKEGFDSISSSSKELLVSALQELESSTSNSPSNKHIHFEYNMSLFLWSESPNDLPSDAAWVSVANRGQFASSGLSMKAQAISPCVQNFCSALDSKLKVKLDDLLAYLPSDDSSLPKDVSPTQAKSSAFDRYADAGTVQEMLRTQSVACIKHIVDCIRAELQSIEEGVQGQQDALNSAKLHSVLFMARLCQSLGELCPHLKQCILGKSESSEKPAREFRALRKQGKVKTQEIIPTQAKWQEVKEVLLQQSVMGYQVWSSAVVK,LQKKALTPSPVAPRSSWFQLCRNLKAAPATPLQISTSTLSTTCRSSSGLRVLMTCLPMRPGSAWQTGVSLPVAASPKHKPSALVYRTSVLPWILSRLNMTSWLTSPLMTHHCPRTFLPHRPRVLPLTDTQMRGPCRRCCGLSPWHASSTSWTASGQSYRALKRVCKGNRMPSTVPSCTQFFSWPDSASPWESCAPISSASWENQRAQRNQQGSLGLENRERKLRKSFLHRPSGKRLKKYSSSRAWATRSGAVQL,SDKRRLLHLQLQGALGFSFAGTKQHQQLPFKAHPLVQHVALPLVESPAFRCGLGQRGKPGSVCQRPLHESTSHQPLCTELLFCPGFAEGTRPPGLPPLLITAQGRFSHTGQEFCLQIRRCGDRAGDAADSVRGMHQAHRGLHPGRATEHRGCARATGCPQQCQAALSSFHGQTLPVPGRAVPPSEAVHPGKIRELRETSKGVGSEKTGKGENSGNHSYTGQVARGRSTPPAERDGLPGLEQCSCE