McDonnell Genome Institute

Washington University

CircRNA

chr17|7224320|7224552|+|ACADVL|ENST00000578319.5

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9984

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

AGQRPESQR

Amino Acids from 5' Exons

AGRAGQRPESQRTCPPGVESEWRAGKWPGVQESLHQGLQPMAPLSPALSPSLKAVRALEQFATVVEAKLIKHKKGIV,RAGLGSGLSLSGLVHPELSRSGELVSGQGSRRACIRDCSRWPLAPHCPHLLRQYGLWSSLPLWWRPSNTRRGLS,GQGWAAAVSADLSTRSVGVASWVARGPGEPASGTAADGPSEPRTVPISGSTGSGAVCHCGGGQADKTQEGDC

Amino Acids from 3' Exons

AGRAGQRPESQRTCPPGVESEWRAGKWPGVQESLHQGLQPMAPLSPALSPSLKAVRALEQFATVVEAKLIKHKKGIV,RAGLGSGLSLSGLVHPELSRSGELVSGQGSRRACIRDCSRWPLAPHCPHLLRQYGLWSSLPLWWRPSNTRRGLS,GQGWAAAVSADLSTRSVGVASWVARGPGEPASGTAADGPSEPRTVPISGSTGSGAVCHCGGGQADKTQEGDC