McDonnell Genome Institute

Washington University

CircRNA

chr17|68983708|68986324|-|ABCA9|ENST00000340001.8

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9256

19

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

MYWFHPTPEK

Amino Acids from 5' Exons

MYWFHPTPEKQIWQRLPAGDEAEEPGTNGAPPCRDPEAFPPGCSAGK,CIGSIQHLKSKFGKDYLLEMKLKNLAQMEPLHAEILRLFPQAAQQE,VLVPSNTKANLAKTTCWRSRTWHKWSPSMQRSGFSPRLLSRK

Amino Acids from 3' Exons

VILKGSGGGEPLGFLGYCPQENALWPNLTVRQHLEVYAAVKGLRKGDAMIAIT,FKGAVEGNPWASWGTALRRMRCGPTQGSTWRCTLPKVSGKGTQSPSH,DFERERWRGTPGLPGVLPSGECAVAQPDSEAAPGGVRCRERSQERGRNDRHHT