McDonnell Genome Institute

Washington University

CircRNA

chr17|68891488|68918546|-|ABCA8|ENST00000430352.6

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9979

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

VLLELEMK

Amino Acids from 5' Exons

NGQDNPIGFLAYIMFWLVLTSSCPPYIAMSSIDDYK,MDRTIQSDSWHISCSGWFHRVAHLTLPAASMII,WTGQSNRIPGIYHVLAGFNIELPTLHCHEQHRL

Amino Acids from 3' Exons

IQRVLLELEMKNIQDVLAQNLSGGQKRKLTFGIAILGDPQ,YKGFCWNWKKIFRMFLLKTVVDRKESPLGLPFEIL,TKGSAGIGNEKYSGCSCSKLKWWTEKKANLWDCHFRRSS