McDonnell Genome Institute

Washington University

CircRNA

chr17|67963332|67975958|+|BPTF|ENST00000342579.7

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

3

Peptide

FYIGCDLCTNWYHGECVGITEK

Amino Acids from 5' Exons

VLYWLSLYLVSWRMCWHHRKGGENGCVHLLTGTRGQQGIVLYLQNTLVT,FYIGCDLCTNWYHGECVGITEKEAKKMDVYICNDCKRAQEGSSEELYCICRTPYDES,SILAVIFVLTGIMENVLASQKRRLRKWMCTSVMIVNGHKRAAVRNCTVSAEHLMMSH

Amino Acids from 3' Exons

TLPPWKKEYKDDIMKSRNLWQIPKFLITVVTTIQVTPHFTSVQKFSNHSLYRNKASKLA,PCHHGRKSTKTILKADGICGRYDQNFLSLLQSKLPILPVCRSSRIILCTEIERLQSQ,LATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKAS