McDonnell Genome Institute

Washington University

CircRNA

chr17|67924546|67948306|+|BPTF|ENST00000306378.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9384

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

7

Peptide

DLQIEVQSGER

Amino Acids from 5' Exons

SGERKGTSSATG,VEKEKAQAVEQQAK,WRKKRHKQLSNRL

Amino Acids from 3' Exons

NDCLPGDEVYFGDRRRKTGSKKTEARECGAETQAECHAVSSALQAQRAAQSRDPEEESTPGQGSANSA,MIVCNQVMKYILDKIDKEEKQAAKKRKREESVEQKRSKQNATKLSALLFKHKEQLRAEILKKRALLDKDLQIEVQ,LSVTRSIFWIRIKKKNRQQKNGSVKRVWSRNVASRMPLSCQLCSSSTKSSSEPRSRREHSWTRICKLKC