McDonnell Genome Institute

Washington University

CircRNA

chr17|67909581|67948306|+|BPTF|ENST00000306378.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9637

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

DLQIEVQPK

Amino Acids from 5' Exons

PKIIWMKIWMSQIKENVHEVQKKKSLILKKMRKVQMLQKEQTKMKWISQRLLRRRTK,QKYGKYGVRKKMFTKSKKNKNRAFKRGKRFRCCKRSRPKNGYLKDYEEGP,KNNMDENMDESDKRKCSRSPKKIKIEPDSEKDEVKGSDAAKGADQNEMDISKITEKKDQ

Amino Acids from 3' Exons

NDCLPGDEVYFGDRRRKTGSKKTEARECGAETQAECHAVSSALQAQRAAQSRDPEEESTPGQGSANSA,MIVCNQVMKYILDKIDKEEKQAAKKRKREESVEQKRSKQNATKLSALLFKHKEQLRAEILKKRALLDKDLQIEVQ,LSVTRSIFWIRIKKKNRQQKNGSVKRVWSRNVASRMPLSCQLCSSSTKSSSEPRSRREHSWTRICKLKC