McDonnell Genome Institute

Washington University

CircRNA

chr17|67875555|67904840|+|BPTF|ENST00000321892.8

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9982

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

4

Peptide

SLEGKPTEVGDK

Amino Acids from 5' Exons

SQQKLGIKVTLCQQILATTQQMQLQKRLVPLKGGALWGVSQKPPIAATWQRRRWHLSSPRMCQ,ANRSWGRLCVSKSWRQHNKCNFRRDSLREEPCGVSLRNPRQQHGREEGGIAPPGCA,PTEVGDKGNSVSANLGDNTTNATSEETSPSEGRSPVGCLSETPDSSNMAEKKVASELPQDVP

Amino Acids from 3' Exons

VWKQKGEEYRVTGYGGWSWISKTHVYRFVPKLPGNTNVNYRKSLEG,FGNKKVKSTEQDMVVGAGLVKLMFIGLFLNCQAILMITESRKE,LETKRRVQSDRIWWLELDNSCLVCSIARQYCELQKVVRR