McDonnell Genome Institute

Washington University

CircRNA

chr17|67632142|67687184|+|PITPNC1|ENST00000299954.13

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

NMHEQTNIK

Amino Acids from 5' Exons

IFDNEAKDVEREVCFIDIACDEIPERYYKESE,FSTMKPKTWREKFALLILPAMKFQSATTKNL,FRQSQRRGERSLLYYCLRNSRALLQRI

Amino Acids from 3' Exons

IQWMMFGNTRKTCMNKPTKFAISIPPLWMTRVMPKQ,YDNGCSGIREKHATNQHKSLQSAFLPCGHRESCPNK,MTMDDVREYEKNMHEQTNIKVCNQHSSPVDDIESHAQTS