McDonnell Genome Institute

Washington University

CircRNA

chr17|67188318|67203443|-|HELZ|ENST00000358691.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9447

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

7

Peptide

VMIDAASTEVLGEGLAK

Amino Acids from 5' Exons

PARMLYRVALLYDAHRPHFSIIAISAGDSTTQVSQEVPENCQEWIGGKMAQNGLDHYVYKVGIAFNTEIFGTFRQTIVFDFGLEPVLMQRVMIDAASTE,LQECCIVHCFMMLIVLILVSLQYLPEIVLPRYHKKSQKTVKNGEERWPKMDIITCIKSGHLTQKYLELFAKPFSTLDWNQYSCKELMQLLQK,CKNAVSCSIALCSSSSFYHCNICRRYYPGITRSPRKLSRMDRRKDGPKWIRSLRVSRDSIHRNIWNFSPNHSFRLWIGTSTHAKSNDCSFYR

Amino Acids from 3' Exons

CWEKDWPREKMPFGQCFAACSKGSSNLYPPFLPSHSQESP,AGRRTGQGRRCLSGSALLHAAEREAPTCIHHSCQVTHRRVP,LGEGLAKGEDAFRAVLCCMQLKGKLQPVSTILAKSLTGESL