McDonnell Genome Institute

Washington University

CircRNA

chr17|67178658|67203443|-|HELZ|ENST00000358691.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9408

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

EISNAGRR

Amino Acids from 5' Exons

ISNTCMQNSSPQLNVGILPLRLLILNLMKLLIWRRAFLSDTKFPSLLTSYLLSPFTNHPRATISHGYMTFFILRRPSIKKSA,SRIPDACKTAASNHSTLGFFLDYYRFTNYFGEEPSYQIPNSPLCPAIYSVRFRQIIDQEQLSVTVTPSLYGDSPVRNQQ,LEYLMHAKQQLVTTAKRWDSSSKTIIDFEPNETTDLEKSLLIRYQIPLSADQLFTQSVLDKSLTKSNYQSRLHDLLYIEEIAQYKEIS

Amino Acids from 3' Exons

CWEKDWPREKMPFGQCFAACSKGSSNLYPPFLPSHSQESP,AGRRTGQGRRCLSGSALLHAAEREAPTCIHHSCQVTHRRVP,LGEGLAKGEDAFRAVLCCMQLKGKLQPVSTILAKSLTGESL