McDonnell Genome Institute

Washington University

CircRNA

chr17|67086828|67145890|-|HELZ|ENST00000358691.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9416

33

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

10

Peptide

VDSYTSELFYEGK

Amino Acids from 5' Exons

YEPRGPGRPLYQRRISSSSVQPCSEEVSTPQDSLAQCKELQDHSNQSSFNFSSPESWVNTTSSTPYQNIPCNGSSRTAQPRELI,MSPEDLVGPCTKEESHLAQFNLVLKKALLKTVWLSVKSFRTTVTNLLSTFHPRSPGTPPHLLLIRTFRAMDPAGQLSPES,AQRTWSALVPKKNLILSSTLFRSKHSSRQSGSVRASGPQPIFFQLFIPGVLGKHHLIYSLSEHSVQWIQQDSSAQRVD

Amino Acids from 3' Exons

LYLAFLGQTDGQWEAASTQRFLPTNFLYSTRRRCTRKKHSFLCR,YTSELFYEGKLMASGKQPAHKDFYPLTFFTARGEDVQEKNSTAFYNNAE,IPLSFSMRANWPVGSSQHTKISTHLSLQHEEKMYKKKIAQLFIIMQ