McDonnell Genome Institute

Washington University

CircRNA

chr17|66773986|66788979|+|PRKCA|ENST00000413366.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9993

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

VIIAYQPYGK

Amino Acids from 5' Exons

IIAYQPYGKSVDWWAYGVLLYEMLAGQ,SLISRMENLWTGGPMASCCMKCLPG,NRLSAVWKICGLVGLWRPVVNACRA

Amino Acids from 3' Exons

LMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKV,PNTQPSGWAVGLRGRGTESMPSSGGSTGKNWRTGRSSHHSSPK,DDQTPSQAAGLWAGGEGRERACLLPEDRLGKTGEQGDPATIQAQS