McDonnell Genome Institute

Washington University

CircRNA

chr17|66732687|66735662|+|PRKCA|ENST00000284384.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.995

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

21

Peptide

VLALLDKPPFLTQLHSCFQTVK

Amino Acids from 5' Exons

KAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGK,KPNLALLATKSSVPLKTGNNLPTTLTENSRTSISSWCWERGVLE,SQTWPCWQQSHQSLRQETTFQQPPSETHGLQFPHGVGKGEFWK

Amino Acids from 3' Exons

VMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTV,CLPTGRAQKNCMQSKSRRMWFRMMTWSAPWKSESWPCLTNPRSRSCTPASRQ,DACRQEGHRRTVCNQNPEEGCGDSGRGVHHGRKASLGPAQTPVLDAAALLLPDS