McDonnell Genome Institute

Washington University

CircRNA

chr17|66641354|66645511|+|PRKCA|ENST00000284384.6

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9803

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

4

Peptide

LHVTGPQEQAQVQNPHLR

Amino Acids from 5' Exons

DPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCD,TPGASTSSKSTLTEAPPSAITVGHCSMDLSIKGNVT,PQEQAQVQNPHLRKPHLLRSLWVTALWTYPSRDEM

Amino Acids from 3' Exons

PAITFTSNASSMSPASAEWITLRRGGGFTRLRLLMKSSMSQ,LRYERSQAMRHQCPQPLRNGSHEEGADLPKGGCKAPCH,CDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVT