McDonnell Genome Institute

Washington University

CircRNA

chr17|66223697|66228196|-|APOH|ENST00000205948.10

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9773

35

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

16

Peptide

WSPELPVCAPCPKPDDLPFSTVVPLK

Amino Acids from 5' Exons

VLSEWRFCQVHGRKMEPGASCLC,FYLNGADSAKCTEEGKWSPELPVCA,FIMALILPSALRKENGARSFLSVL

Amino Acids from 3' Exons

PVPSQMIYHFPQWSRKHSMSQEKRLRIPASRAMCPEEGESLSALSQDCGPSTLNVH,LSQARFTIFHSGPVKNILARRRDYVFLQAGLCVPRRDEKVYLPSHRTVAHQHSEMY,CPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCT