McDonnell Genome Institute

Washington University

CircRNA

chr17|6483516|6538082|-|PITPNM3|ENST00000262483.12

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9959

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

13

Peptide

LSLSGPPPGGGAPWHLR

Amino Acids from 5' Exons

EGCPQRSCKTHVLLLVLHGGNILDTGAGDPSCKAADIHTFSSVLEKVTRAHFPAALGHILIKFVPCPAICSEAFSLVS,KAARSAPARHMSSCWSCMGETSWTRVPGTRPARQPTSTPSAPCWRRSHEPISLLPWATSSSSSSPVLPSALRLSRLSL,RLPAALLQDTCPPAGPAWGKHPGHGCRGPVLQGSRHPHLQLRAGEGHTSPFPCCPGPHPHQVRPLSCHLLGFLACLS

Amino Acids from 3' Exons

VVLPRAAVPPGTFEMSSVTLWRAQMMNSLMPE,WSSPGRRCPLAPSKCPQLCGELRILCQ,GPPPGGGAPWHLRNVLSDSVESSDDEFFDAR