McDonnell Genome Institute

Washington University

CircRNA

chr17|64562770|64583544|-|SMURF2|ENST00000262435.13

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9373

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

4

Peptide

EEIFELGRK

Amino Acids from 5' Exons

SAEPIERPTATASGIVMSHRMPDSPKVQARPGSETKNFAARTFPTTASGRSLPHGFQGRDF,RQNQLKDQQQQQVVSLCPDDTECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFE,GRTNKTNSNSKWYRYVLMTQNAQSQGTSETWFRNKFCGKNFPNNSLRQVIAALRFPGKRFL

Amino Acids from 3' Exons

LGRKENRLWKNPVSKPYNKNYAMGAPNT,WEERRTASGRIQYLNHITRTTQWERPT,GKKGEPPLEESSITIQELRNGSAQH