McDonnell Genome Institute

Washington University

CircRNA

chr17|64531889|64534737|+|CEP95|ENST00000553956.6

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9988

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

EEMEKIYR

Amino Acids from 5' Exons

EKIYRGEAVRKGTPECSQPWKIYSRKTTTQSLRGGLPKPNKAVP,KKYTEEKLFVKELQNVVSPGRFTLEKPQRRVEVASQSQIKQFQ,KNIQRRSCSRNSRMSALEDLLKNHNAESKRWPPKAKSSS

Amino Acids from 3' Exons

QDFKDCIRRQRLTQSKIKENRQQIVRARKYYDDYRVQLCAKMMRMRTREEM,KTSRTAFVGKGPNQRKKIDSKSFVLENIMMIIEFSCVQKEGPGKK,RLQGLHSAKVDPIKDKRKSTANRSCSKILLSSVVCKNDENEDPGRN