McDonnell Genome Institute

Washington University

CircRNA

chr17|63604533|63607464|+|TACO1|ENST00000258975.6

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

12

Peptide

ETEDEEERNVFKK

Amino Acids from 5' Exons

KEAPTLSTTATWPISRCVAANICPSQRLRQHKW,RRPQPAQQQPGQYLRGVSQQTYAQVNDDSTENG,GGPNPEHNSNLANILEVCRSKHMPKSTIETALKME

Amino Acids from 3' Exons

RSDGCRSSSLFQKGGDCGSGGQREEGCEPRACPGDGNRSRSGCQGNRRRKERF,GVMAVGARHSFDKKGVIVVEVEDREKKAVNLERALEMAIEAGAEDVKETEDEEERNVFK,EWLELVTLLTKRGLWLKWRTERRRLTSVPWRWQSKQELRMSRKLKMKKKGTFL