McDonnell Genome Institute

Washington University

CircRNA

chr17|63538064|63538662|+|KCNH6|ENST00000314672.9

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9933

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

DHPAPVLGHR

Amino Acids from 5' Exons

PCTPASSGTCPRSSSACTRAPRATTRRCCVSRSSSASTRSPTHCASAWRSISSTPGPTPMALTT,PDVRQHLRERVRDHPAPVLGHRALPHADAACQGVHPLPPDPQPTAPAPGGVFPARLVLHQWHHER,LMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNA

Amino Acids from 3' Exons

VLKGFPECLQADICLHLHRALLQHCPAFSGAGKGCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAIL,CRASPSACRLTSACTCTAHCCSTAQLSAAPARAACARPSSSRPPTRRLGTRWCTSATCSPPSTSSPEAPSRSCATTWSWPS,AEGLPRVPAGHLPAPAPRTAAALPSFQRRRQGLPARASRQVQDHPRAAWGHAGAPRRRALHPLLHLPRLHRDPARRRGRGHP