McDonnell Genome Institute

Washington University

CircRNA

chr17|63486556|63488791|+|ACE|ENST00000290863.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9274

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

LPGSMLQK

Amino Acids from 5' Exons

LQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEE,CRRTCKPTTPSTAPRPGSLMTSCRTPLSSGSRRFRTNGQHCLPRSWR,AEEHANSQPHPEVRHPGQEVCEPVAEHHYQADHKEGSGPRTGSTACPGAGG

Amino Acids from 3' Exons

IRMWPRPGNMKTCYGHGRAGETRRGEPSSSFTRNTWNSSTRLPGSM,SDECDGHVPEIRPVMGMGGLARQGGESHPPVLPEIRGTHQPGCPAQ,LTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLN