McDonnell Genome Institute

Washington University

CircRNA

chr17|623532|710613|-|VPS53|ENST00000291074.9

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9118

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

10

Peptide

FSGCTLTDGTLVFPSQDPLDR

Amino Acids from 5' Exons

GRTCQDYAYQSEGNSEIASFCYSKNNLGVSCKTLLRLHPDRWDP,AELAKIMRTRAKEIEVKLLLFAIQRTTNFEGFLAKRFSGCTLTDGTL,QNLPRLCVPERRKLKNCFFLLFKEQLTLRGFLQNASPAAPPMGP

Amino Acids from 3' Exons

VFPSQDPLDRADFNAVEYINTLFPTEQ,CFQARTLIEQISMLLSISIPCSQPS,VSKPGPSRSSRFQCCVYQYPVPNRA