McDonnell Genome Institute

Washington University

CircRNA

chr17|61982197|61983114|-|MED13|ENST00000397786.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9173

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

NVMEVIWIK

Amino Acids from 5' Exons

WKYGSRIWHCLYTSNSYFFWDASQCTSQRSRNSSFSIHPSVSNSKDSKDSSDSSWSWWTCCSRFSQIKFRLVFTSFYPIYMQTPFCTCNCPFHPSTQSLCKPHPFRISYEFVRLLLLHLCLQHEHQGCRCWSLHSRSNAGSTIVYLWLQCCHEQKIWKQFRIISRTRYHRTQYRLWQRSRKTFSSQGYLCTCWRTKGIKIIFDIIATRSVHFIFTLWSSRPRSFSKWCNQLGTCRALLQLLPCIRTWASVHGHVRRKSSTCEKFMLTPLVQKK,DGSNMDQEYGTAYTPQTHTSFGMPPSSAPPSNSGAGILPSPSTPRFPTPRTPRTPRTPRGAGGPASAQGSVKYENSDLYSPASTPSTCRPLNSVEPATVPSIPEAHSLYVNLILSESVMNLFKDCNFDSCCICVCNMNIKGADVGVYIPDPTQEAQYRCTCGFSAVMNRKFGNNSGLFLEDELDIIGRNTDCGKEAEKRFEALRATSAEHVNGGLKESEKLSDDLILLLQDQCTNLFSPFGAADQDPFPKSGVISNWVRVEERDCCNDCYLALEHGRQFMDNMSGGKVDEALVKSSCLHPWSKRN,MEVIWIKNMALLIHLKLILLLGCLLAVHLLVTAEQEFFLLHPPLGFQLQGLQGLLGLLVELVDLLVLKVQSNMKIQTCIHQLLPHLHADPLILLNLQLSLPSLKHTVFMTSSFQNQLICLKTVTLIVVASVFATTSRVPMLEFTFQIQRRKHNIGVPVASVLSTENLETIQDYFLKMNISDAIQTVAKKQKNVLKLSGLPLLNMLMEDRNLKNYLMIYYCYKISALIYFHPLEQQTKILFLKVVLAIGYVLKSVTVAMTATLHNMGVSSWITCQEEKLMKHLKVHAYTPGPKET

Amino Acids from 3' Exons

WKYGSRIWHCLYTSNSYFFWDASQCTSQRSRNSSFSIHPSVSNSKDSKDSSDSSWSWWTCCSRFSQIKFRLVFTSFYPIYMQTPFCTCNCPFHPSTQSLCKPHPFRISYEFVRLLLLHLCLQHEHQGCRCWSLHSRSNAGSTIVYLWLQCCHEQKIWKQFRIISRTRYHRTQYRLWQRSRKTFSSQGYLCTCWRTKGIKIIFDIIATRSVHFIFTLWSSRPRSFSKWCNQLGTCRALLQLLPCIRTWASVHGHVRRKSSTCEKFMLTPLVQKK,DGSNMDQEYGTAYTPQTHTSFGMPPSSAPPSNSGAGILPSPSTPRFPTPRTPRTPRTPRGAGGPASAQGSVKYENSDLYSPASTPSTCRPLNSVEPATVPSIPEAHSLYVNLILSESVMNLFKDCNFDSCCICVCNMNIKGADVGVYIPDPTQEAQYRCTCGFSAVMNRKFGNNSGLFLEDELDIIGRNTDCGKEAEKRFEALRATSAEHVNGGLKESEKLSDDLILLLQDQCTNLFSPFGAADQDPFPKSGVISNWVRVEERDCCNDCYLALEHGRQFMDNMSGGKVDEALVKSSCLHPWSKRN,MEVIWIKNMALLIHLKLILLLGCLLAVHLLVTAEQEFFLLHPPLGFQLQGLQGLLGLLVELVDLLVLKVQSNMKIQTCIHQLLPHLHADPLILLNLQLSLPSLKHTVFMTSSFQNQLICLKTVTLIVVASVFATTSRVPMLEFTFQIQRRKHNIGVPVASVLSTENLETIQDYFLKMNISDAIQTVAKKQKNVLKLSGLPLLNMLMEDRNLKNYLMIYYCYKISALIYFHPLEQQTKILFLKVVLAIGYVLKSVTVAMTATLHNMGVSSWITCQEEKLMKHLKVHAYTPGPKET