McDonnell Genome Institute

Washington University

CircRNA

chr17|61877886|61885005|-|INTS2|ENST00000251334.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9284

21

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

4

Peptide

LWMVLNTVMPRSCHAK

Amino Acids from 5' Exons

HFQLSQITHKCRLNTLYSLPVNLYHMRKCHPIASYIQGFHGEFCKQSINYGWFLILCLE,IFSCPSKHTSDADYRTLDSTLCQTYTICGSVNIQYEPAIEFRGSTENSANSQTMDGSYCDAK,FSAVPVNNTQVMQIIEHLTLLSASELIPYAEVLTSNMSQLLNSGVPRRILQTVNKLWMVLNTVMPR

Amino Acids from 3' Exons

LPCKESPNHILLLWIRFLSNSLFDRLKGCSRSWE,CHAKKAQIIFFFFNGSDSYQIPYSTGSRAAAGVG,AMQRKPKSYSSSLMDQIPIKFLIRQAQGLQQELG